PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen11g027660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 710aa    MW: 78778.5 Da    PI: 7.5086
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen11g027660.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-094384751954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Sopen11g027660.1 438 FEHflHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVR 475
                       554459******************************88 PP

2BELL115.33e-37302373172
              BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       +rqelq+kkakL+s+l+eVd+rY+qy++q+q+++ sFe+ +g+gs+k+Yt+lAl++iS++FrcLkdai++qi
  Sopen11g027660.1 302 QRQELQMKKAKLVSMLDEVDQRYRQYHHQMQMIATSFEQTTGIGSSKSYTQLALHTISKQFRCLKDAISGQI 373
                       69*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.8E-52233371IPR006563POX domain
PfamPF075265.0E-45236370IPR006563POX domain
PROSITE profilePS5007111.92416479IPR001356Homeobox domain
SMARTSM003894.2E-10419483IPR001356Homeobox domain
CDDcd000864.17E-12419480No hitNo description
SuperFamilySSF466895.56E-17421486IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-29422486IPR009057Homeodomain-like
PfamPF059202.8E-18436475IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MYYQGGSEIQ ADGLQTLYLM NPNYIGYNDT HHHHHHHHQH QQQSSNMFLL NSVAAGSFPH  60
VSLPLQAHAQ GHLVGVPLPS GFQDSNRPSI QEISASHHGL LSRLWTSGDQ STPRGGDGGG  120
GGGEVNGSKS HIPSSTVVSP NSGSGGGTTT DFASQLGFQR PGLVSPTQAH HQGLSLSLSP  180
QQQMNFRSSL PLDHREISTT NHQVGILSSS PGINTSNIDH TRGSGASSSF SISNGMILGS  240
KYLKVAQDLL DEVVNVGKNI KLSKVGGAKE KHKLENELIS LASDDIESNS QKNSVVELTT  300
AQRQELQMKK AKLVSMLDEV DQRYRQYHHQ MQMIATSFEQ TTGIGSSKSY TQLALHTISK  360
QFRCLKDAIS GQIKDTNKTL GEEENIGGKI EGSKLKFVDH HLRQQRALQQ LGMMQTNVWR  420
PQRGLPERAV SVLRAWLFEH FLHPYPKDSD KIMLAKQTGL TRSQVSNWFI NARVRLWKPM  480
VEEMYMEEVK KNNQEQNGLD QKNIEPNNNE IVGSKSSAPQ EKLPISSNII HDATSNDIST  540
STISTSPTGG GGSIPAQTVG GFSLIRSLNM DNIDDQRNNK KARNEMQNST IISMEREIMN  600
KVKSEKFNNT QTRECYTLMT PSYTMDDDHQ FGTRFNNQNH EQLATTFHQG NNGHVSLTLG  660
LPPNSENQHN YIGLENHYNQ PTHHPNISYE NIDFQSGKRY ATQLLQDYVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16425483563Homeobox protein Meis2
3k2a_B3e-16425483563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4066980.0AF406698.1 Solanum tuberosum BEL1-related homeotic protein 11 (Bel11) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015058451.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_015058452.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLK4DA520.0K4DA52_SOLLC; Uncharacterized protein
STRINGSolyc11g068950.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-90BEL1-like homeodomain 1